Cat#:RP-5213H;Product Name:Recombinant Human PRL R Protein;Synonym:PRL-R, hPRLrI.;Description:Extra Cellular Domain Prolactin Receptor Protein produced in E.coli is a non-glycosylated, Polypeptide chain containsing 210 amino acids and having a molecular mass of 23.97 kDa. The Prolactin Receptor is purified by proprietary chromatographic techniques according to Bignon et al. (1994) JBC 269; 3318-24 and tested according to Gertler et al. (1996) JBC 271; 24482-91.;Source:E.coli;AA Sequence:AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCH FGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYL WIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVR CKPDHGYWSAWSPATFIQIPSDFTMNDTTVW.;Purity:Greater than 97.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. (c) Gel filtration at pH 8 under non denaturative conditions.;Bioactivity:Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio.;Formulation:The Prolactin Receptor was lyophilized from a concentrated (0.4mg/ml) solution with 0.0045mM NaHCO3.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized PRLR in sterile 18M-cm H2O not less than 100µg/ml and not more than 1 mg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -18°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles as they cause oligomerization of the protein.;