Cat#:RPH-NP316;Product Name:Recombinant Human PLA2G1B / PLA2 / PLA2A Protein;Synonym:PLA2G1B/Phospholipase A2/Group IB phospholipase A2/PLA2/PLA2A/PPLA2;Description:Recombinant Human PLA2G1B Protein is produced in Human Cells and the target gene encoding Ala23-Ser148 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:AVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLL DNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQSVDHH HHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human PLA2G1B/PLA2/PLA2A Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,10% Glycerol,pH8.0.;Stability:Recombinant Human PLA2G1B/PLA2/PLA2A Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Phosphofructokinase 1/PFKM/PFKX Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;