Cat#:RP-5086H;Product Name:Recombinant Human PLA2G10 Protein;Synonym:Group 10 secretory phospholipase A2, EC 3.1.1.4, Group X secretory phospholipase A2, Phosphatidylcholine 2-acylhydrolase GX, GX sPLA2, sPLA2-X, SPLA2, GXPLA2, MGC119918, MGC119919, MGC133367, PLA2G10.;Description:Secreted Phospholipase A2-X Protein is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined). MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ PRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQE LLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.;Source:E.coli;Purity:Greater than 95% as determined by SDS PAGE.;Formulation:Sterile filtered and lyophilized from 0.5 mg/ml in 0.01M Tris buffer pH 7.2.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:Add 0.2 ml of distilled water and let the lyophilized pellet dissolve completely.;Storage:Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.;