Cat#:RPH-NP330;Product Name:Recombinant Human Proprotein Convertase Subtilisin / Kexin Type 9 / PCSK9 Protein(C-His / HA / AVI);Synonym:Proprotein Convertase Subtilisin/Kexin Type 9, Neural Apoptosis-Regulated Convertase 1, NARC-1, Proprotein Convertase 9, PC9, Subtilisin/Kexin-Like Protease PC9, PCSK9, NARC1;Description:Recombinant Human Proprotein Convertase 9 Protein is produced in Human Cells and the target gene encoding Gln31-Gln692 is expressed with a His/HA/AVI tag at the C-terminus.;Source:Human Cells;AA Sequence:QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTA RRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLER ITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDS HGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLA GGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNF GRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSA KDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAIARCAPDEELLS CSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRV HCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGI PAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEEAVTAVAICCR SRHLAQASQELQEFGGHHHHHHHHGYPYDVPDYASGGGLNDIFEAQKIEWHE;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human ProProtein Convertase Subtilisin/Kexin Type 9/PCSK9 Protein (C-His/HA/AVI)was supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, pH 7.4.;Stability:Recombinant Human ProProtein Convertase Subtilisin/Kexin Type 9/PCSK9 Protein (C-His/HA/AVI)is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human ProProtein Convertase Subtilisin/Kexin Type 9/PCSK9 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Proprotein Convertase 9 Protein is produced in Human Cells and the target gene encoding Gln31-Gln692 is expressed with a His/HA/AVI tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human ProProtein Convertase Subtilisin/Kexin Type 9/PCSK9 Protein (C-His/HA/AVI)was supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, pH 7.4.
Stability:
Recombinant Human ProProtein Convertase Subtilisin/Kexin Type 9/PCSK9 Protein (C-His/HA/AVI)is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human ProProtein Convertase Subtilisin/Kexin Type 9/PCSK9 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.