• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human OSM Protein, 209 a.a Online Inquiry

  • Cat#:
  • RP-4877H
  • Product Name:
  • Recombinant Human OSM Protein, 209 a.a
  • Synonym:
  • OSM, MGC20461, Oncostatin M.
  • Description:
  • Oncostatin-M (209 a.a.) Protein produced in E.coli is a single, non-glycosylated polypeptide chain containing 209 amino acids and having a molecular mass of 23.9kDa. The Oncostatin-M (209 a.a.) is purified by proprietary chromatographic techniques.
  • Source:
  • E.coli
  • AA Sequence:
  • AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPG AFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDL EKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQ RKLEGCRFLHGYHRFMHSVGRVFKWGESPNRSRRHSPHQALRKGVRR.
  • Purity:
  • Greater than 97.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • Bioactivity:
  • The ED50 as determined by the dose-dependant stimulation of Human TF-1 cells is < 2 ng/ml, corresponding to a Specific Activity of 500,000 IU/mg.
  • Formulation:
  • Oncostatin-M (209 a.a.) was lyophilized from a concentrated (1mg/ml) solution containing 1x PBS pH-7.4.
  • Stability:
  • Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
  • Reconstitution:
  • It is recommended to reconstitute the lyophilized Oncostatin-M (209 a.a.) in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
  • Storage:
  • Lyophilized Oncostatin-M (209 a.a.) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Oncostatin-M (209 a.a.) should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Pre product:Recombinant Human OSM Protein, 195 a.a-Advanced Biomart
  • Online Inquiry

    refresh