Cat#:RP-4858H;Product Name:Recombinant Human Omp Pylori Protein;Description:Omp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein having the Mw of 23 kDa. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients.;Source:E.coli;AA Sequence:MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWP KDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWK NTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLI DKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCP AGWRKGDKGMKATHQGVAEYLKENSIKL.;Purity:Greater than 95% pure as determined by 12% PAGE (Coomassie staining).;Formulation:The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.;