Cat#:RP-4793H;Product Name:Recombinant Human NRG1 Protein;Synonym:Neuregulin-1, NRG1, GGF, HGL, HRGA, NDF, SMDF, HRG, ARIA, GGF2, HRG1.;Description:Recombinant Human Neuregulin-1 beta 2 produced in E.coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having a total molecular mass of 7055 Dalton. NRG-1 is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ.;Purity:Greater than 96.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.;Bioactivity:The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 50ng/ml, corresponding to a specific activity of > 2.0 × 104 IU/mg.;Formulation:Lyophilized from a 0.2µm filtered solution in PBS, pH 7.4.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized NRG1 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Heregulin should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.;