Cat#:RP-4787H;Product Name:Recombinant Human NR1H2 Protein;Synonym:Liver X receptor beta, LXRB, NER, NER-I.;Description:LXRB Protein produced in plants is a single polypeptide chain containing 293 amino acids and having a total molecular mass of 31.9kDa. The LXRB is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.;Source:Nicotiana benthamiana.;AA Sequence:HHHHHHSSGIEGRGRLIKHMTPGGSEAGSQGSGEGEGVQ LTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQ SRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQ IALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRA GLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNV QEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLV SLR;Purity:Greater than 95.0% as determined by SDS-PAGE.;Formulation:Lyophilized from a concentrated (1mg/ml) solution containing 20mM Tris Hcl pH-8 & 0.1% SDS.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized NR1H2 in sterile water & 50ug/ml BSA at a concentration of 1mg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized LXRB although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution LXRB Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;