Cat#:RP-4772H;Product Name:Recombinant Human Noggin Protein;Synonym:SYM1, SYNS1, NOG.;Description:Noggin Protein produced in E.coli is a non-glycosylated, non-disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.2 kDa (each chain 23.1 kDa). Noggin is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPP EDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLR RKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHL TVLRWRCQRRGGQRCGWIPIQYPIISECKCSC.;Purity:Greater than 95.0% as determined by SDS-PAGE.;Bioactivity:The ED50 was determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The expected ED50 for this effect is 0.05-0.08 µg/ml of Noggin, corresponding to a Specific Activity of 12,500-20,00;Formulation:Lyophilized from a 0.2μm filtered solution in 30% CH3CN, 0.1% TFA.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Further dilutions should be made in appropriate buffered solutions.;Storage:Lyophilized Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Noggin should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;