• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human MOG Protein Online Inquiry

  • Cat#:
  • RP-4577H
  • Product Name:
  • Recombinant Human MOG Protein
  • Synonym:
  • Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137.
  • Description:
  • Myelin Oligodendrocyte Glycoprotein produced in E.coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa.
  • Source:
  • E.coli
  • AA Sequence:
  • MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRN GKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQE EAAMELKVEDPFYWVSPGHHHHHH.
  • Purity:
  • Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • Formulation:
  • The Myelin Oligodendrocyte Glycoprotein 0.5mg/ml solution was lyophilized from 20mM sodium acetate buffer pH-4 and 0.3M sodium chloride.
  • Stability:
  • Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
  • Reconstitution:
  • It is recommended to reconstitute the lyophilized MOG in sterile 10mM Acetic acid not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
  • Storage:
  • Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Pre product:Recombinant Human MOG Protein-Advanced Biomart
  • Online Inquiry

    refresh