Cat#:RP-4560H;Product Name:Recombinant Human MMP 9 Protein;Synonym:Matrix metalloproteinase-9, MMP-9, 92 kDa type IV collagenase, 92 kDa gelatinase, Gelatinase B, GELB, MMP9, CLG4B.;Description:MMP-9 Protein produced in E.coli is single, a non-glycosylated, Polypeptide chain containing 338 amino acids fragment (113-450) corresponding to the catalytic domain of the protein, having a total molecular mass of 42.03kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The MMP-9 is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:4.5kDa His Tag-DLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDAD IVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFP FIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSA CTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVF;Purity:Greater than 95.0% as determined by SDS-PAGE.;Formulation:MMP-9 protein is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.;
Matrix metalloproteinase-9, MMP-9, 92 kDa type IV collagenase, 92 kDa gelatinase, Gelatinase B, GELB, MMP9, CLG4B.
Description:
MMP-9 Protein produced in E.coli is single, a non-glycosylated, Polypeptide chain containing 338 amino acids fragment (113-450) corresponding to the catalytic domain of the protein, having a total molecular mass of 42.03kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The MMP-9 is purified by proprietary chromatographic techniques.
Source:
E.coli
AA Sequence:
4.5kDa His Tag-DLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDAD IVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFP FIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSA CTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVF
Purity:
Greater than 95.0% as determined by SDS-PAGE.
Formulation:
MMP-9 protein is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.
Stability:
Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
Storage:
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.