Cat#:RP-4521H;Product Name:Recombinant Human MIF Protein His N;Synonym:Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.;Description:MIF Protein, fused to His-tag at N-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques. Macrophage Inducing Factor Protein is a single, non-glycosylated, polypeptide chain having amino acids from 1-114 and having a molecular mass of 16.6 kDa.;Source:E.coli;AA Sequence:MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMPMFIVNTNV PRASVPDGFL SELTQQLAQA TGKPPQYIAV HVVPDQLMAF GGSSEPCALC LHSIGKIGGA QNRSYSKLLC GLLAERLRIS PDRVYINYYD MNAANVGWNN STFA.;Purity:Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.;Formulation:1mg/ml solution containing PBS pH-7.4.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Liquid MIF although stable 4°C for 1 week, should be stored below -18°C. Please prevent freeze-thaw cycles.;