Cat#:RP-4510H;Product Name:Recombinant Human MIA Protein;Synonym:Melanoma-derived growth regulatory protein precursor, Cartilage-derived retinoic acid-sensitive protein, CD-RAP, MIA.;Description:Melanoma Inhibitory Activity Protein produced in E.coli is a single, non-glycosylated, polypeptide chain consisting of 108 amino having a total molecular mass of 12237 Dalton. The MIA is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:Agrees with the sequence of native MIA human with an addition N-terminal Methionine residue. MGPMPKLADRKLCADQECSSHPISMAVALQDYMAPDCRFLTIHRGQVV YVFSLKGRGRFLWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKVDVKT DKWDFYCQ.;Purity:Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.;Bioactivity:The biological activity is calculated by the inhibiting effect on the invasion of Mel In Tumor cells and found active in Mel In assay.;Formulation:The protein was lyophilized from a concentrated (1mg/ml) solution containing 20mM Potassium-phosphate pH=7 and 150mM potassium chloride.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized Melanoma Inhibitory Activity in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized MIA although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIA should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.;