Cat#:RP-4479H;Product Name:Recombinant Human MECP2 Protein;Synonym:Methyl CpG binding protein 2 (Rett syndrome), MeCp-2 protein, AUTSX3, MRX16, MRX79, MRXS13, MRXSL, PPMX, RTT, Mental retardation, X-linked 16, DKFZp686A24160.;Description:MECP2 Protein is expressed in 293 cells. The protein contains 486 amino acids (1-486a.a.) and fused to an N-terminal Flag tag, having an Mw of 53.56kDa.;Source:Mammalian system, 293 cells.;AA Sequence:MDYKDDDDKMVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSA EPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAG KYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGT GRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTST;Purity:Greater than 80% as determined by SDS-PAGE.;Formulation:The MECP2 solution (0.45mg/ml) contains 50mM Tris, 135mM NaCl, 20% Glycerol, pH 7.5 and 200µg/ml FLAG peptide.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:MECP2 although stable 4°C for 4 weeks, should be stored below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;
MECP2 Protein is expressed in 293 cells. The protein contains 486 amino acids (1-486a.a.) and fused to an N-terminal Flag tag, having an Mw of 53.56kDa.
The MECP2 solution (0.45mg/ml) contains 50mM Tris, 135mM NaCl, 20% Glycerol, pH 7.5 and 200µg/ml FLAG peptide.
Stability:
Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
Storage:
MECP2 although stable 4°C for 4 weeks, should be stored below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.