Cat#:RP-11677H;Product Name:Recombinant Human ME3 Protein, His Tag;Synonym:NADP-ME, ME3, malic enzyme 3, NADP-dependent malic enzyme, mitochondrial, mitochondrial NADP(+)-dependent malic enzyme 3, pyruvic-malic carboxylase;Background:Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+)-dependent isoform, and a mitochondrial NAD(+)-dependent isoform. This gene encodes a mitochondrial NADP(+)-dependent isoform. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq, Jul 2008];Description:Recombinant Human ME3 Protein expressed in E.coli, was fused with His Tag. The ME3 human was purified using our unique purification method.;Source:E. coli;AA Sequence:AYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALRITNNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKAEATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKSVTLEDGKTFIPGQGNNAYVFPGVALGVIAGGIRHIP;Formulation:Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0) and 10% glycerol.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. ;Host Species:Human;Storage:Store the human ME3 protein at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.;References:Influential factor contributing to the isoform-specific inhibition by ATP of human mitochondrial NAD(P)+-dependent malic enzyme: functional roles of the nucleotide binding site Lys346. Hsieh JY, et al. FEBS J, 2008 Nov. PMID 18959763;
Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+)-dependent isoform, and a mitochondrial NAD(+)-dependent isoform. This gene encodes a mitochondrial NADP(+)-dependent isoform. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq, Jul 2008]
Description:
Recombinant Human ME3 Protein expressed in E.coli, was fused with His Tag. The ME3 human was purified using our unique purification method.
Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0) and 10% glycerol.
Stability:
Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
Reconstitution:
Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Host Species:
Human
Storage:
Store the human ME3 protein at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.
References:
Influential factor contributing to the isoform-specific inhibition by ATP of human mitochondrial NAD(P)+-dependent malic enzyme: functional roles of the nucleotide binding site Lys346. Hsieh JY, et al. FEBS J, 2008 Nov. PMID 18959763
USA: 1-862-686-3631
Fax: 1-323-978-5598
Email: