Cat#:RP-4347H;Product Name:Recombinant Human LR3 IGF1 Protein;Synonym:R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, LONG R3IGF1, LONG R3 IGF-1, LONG R3IGF-1.;Description:The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals. Recombinant Human LR3 IGF1 protein produced in E.coli is a single, non-glycosylated, polypeptide chain containing 83 amino acids and having a molecular mass of 9.1kDa. The recombinant human LR3 IGF1 protein is purified by our unique chromatographic techniques.;Source:E.coli;AA Sequence:MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA.;Purity:Greater than 95.0% as determined by SDS-PAGE and HPLC.;Bioactivity:The ED50 of recombinant human LR3 IGF1 protein as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg.;Formulation:The recombinant human LR3 IGF1 protein was lyophilized from a 0.2µm filtered concentrated solution in 1xPBS.;Stability:Recombinant human LR3 IGF1 Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized recombinant human LR3 IGF1 protein in sterile 18M-cm H2O at a concentration of 100µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized recombinant human LR3 IGF1 protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution the recombinant human LR3 IGF1 protein should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles.;References:Tomas FM, Knowles SE, Owens PC, Chandler CS, Francis GL, Read LC, Ballard FJ (1992). "Insulin-like growth factor-I (IGF-I) and especially IGF-I variants are anabolic in dexamethasone-treated rats". Biochem. J. 282 ( Pt 1): 91–7. ;