Cat#:RP-10936H;Product Name:Recombinant Human KAT2A / GCN5 Protein, His Tag;Synonym:GCN5; Histone acetyltransferase KAT2A; hGCN5; GCN5L2; PCAF-b; lysine acetyltransferase 2A; GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2; General control of amino acid synthesis, yeast, homolog-like 2; K(lysine) acetyltransferase 2A; STAF97;Background:Gene ID: 2648. KAT2A, the full name is lysine acetyltransferase 2A. KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT-independent manner (Mao et al., 2009 [PubMed 19339690]).[supplied by OMIM, Sep 2009]. HIV-1 NL4-3 replication requires KAT2A as replication is inhibited when KAT2A is deleted through CRISPR/Cas9 genome editing. Knockdown of K(lysine) acetyltransferase 2A (KAT2A; GCN5L2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells.;Description:KAT2A human recombinant was expressed in E.coli and purified using our unique purification method. ;Source:E. coli;AA Sequence:EYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRK;Purity:85%, by SDS-PAGE with Coomassie Brilliant Blue staining.;Formulation:Recombinant human KAT2A Protein was lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0) and 10% glycerol.;Stability:Human GCN5 Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:Reconstitute the human KAT2A protein at 0.25 µg/μl in 200 μl sterile water for short-term storage. ;Host Species:Human;Storage:Store the GCN5 human at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.;References:Knock down of GCN5 histone acetyltransferase by siRNA decreases ethanol-induced histone acetylation and affects differential expression of genes in human hepatoma cells. Choudhury M, et al. Alcohol, 2011 Jun. PMID 21367571;