Cat#:RP-4142H;Product Name:Recombinant Human Inhibin a Protein;Synonym:Inhibin a;Description:Inhibin-Alpha Protein produced in E.coli is a non-glycosylated, polypeptide chain containing 264 amino acids comprising of both A and B chains, having a molecular mass of 33.5 kDa. The Inhibin-Alpha is fused with an amino-terminal hexahistidine tag. The Inhibin-Alpha is purified by standard chromatographic techniques.;Source:E.coli;AA Sequence:Alpha chain: STPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIP PNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI. Beta Chain: GLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTSGSSLSFHSTVINHYRMR GHSPFANLKSCCVPTKLRPMSML;Purity:Greater than 95.0% as determined by SDS-PAGE analysis.;Formulation:Inhibin-A alpha chain is supplied in 1x PBS and 50% glycerol.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.;