Cat#:RPH-NP189;Product Name:Recombinant Human Inosine-5'-Monophosphate Dehydrogenase 2 / IMPDH2 Protein;Synonym:Inosine-5'-monophosphate dehydrogenase 2, IMPDH2, IMP dehydrogenase 2, IMPD 2, IMPDH 2, IMPDH-II, IMPD2.;Description:Recombinant Human IMPDH2 Protein is produced in E.coli and the target gene encoding Met1-Phe514 is expressed with a His tag at the N-terminus.;Source:E. coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFT ADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKY EQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFL EEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVV TAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNV GHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEAD KIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVE GGVHSLHSYEKRLF;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Inosine-5'-Monophosphate Dehydrogenase 2/IMPDH2 Protein was supplied as a 0.2 μm filtered solution of 20mM Tris 150mM NaCl pH 8.0 .;Stability:Recombinant Human Inosine-5'-Monophosphate Dehydrogenase 2/IMPDH2 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Inosine-5'-Monophosphate Dehydrogenase 2/IMPDH2 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Inosine-5'-Monophosphate Dehydrogenase 2/IMPDH2 Protein was supplied as a 0.2 μm filtered solution of 20mM Tris 150mM NaCl pH 8.0 .
Stability:
Recombinant Human Inosine-5'-Monophosphate Dehydrogenase 2/IMPDH2 Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Inosine-5'-Monophosphate Dehydrogenase 2/IMPDH2 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.