Cat#:RPH-NP191;Product Name:Recombinant Human Insulin-Like Growth Factor I / IGF1 Protein;Synonym:Insulin-Like Growth Factor I, IGF-I, Mechano Growth Factor, MGF, Somatomedin-C, IGF1, IBP1;Description:Recombinant Human Insulin-like Growth Factor I Protein is produced in E.coli and the target gene encoding Gly49-Ala118 is expressed.;Source:E.coli;AA Sequence:GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLK PAKSA;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.05 ng/µg (0.5 IEU/µg) as determined by LAL test.;Bioactivity:ED50 is greater than 200 ng/ml.;Formulation:Recombinant Human Insulin-Like Growth Factor I/IGF1 Protein was lyophilized from a 0.2 μm filtered solution of 300mM NaAc, pH 6.5.;Stability:Recombinant Human Insulin-Like Growth Factor I/IGF1 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 500mM Acetic Acid.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IGF1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IGF1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IGF1 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;