Cat#:RPH-NP386;Product Name:Recombinant Human / Mouse / Rat Irisin / FNDC5 Protein;Synonym:Fibronectin type III domain-containing protein 5, Fibronectin type III repeat-containing protein 2, Irisin, FNDC5;Description:Recombinant Human/Mouse/Rat Irisin Protein is produced in Human Cells and the target gene encoding Asp32-Glu143 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLE EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human/Mouse/Rat Irisin/FNDC5 Protein was lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.;Stability:Recombinant Human/Mouse/Rat Irisin/FNDC5 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant Irisin protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant Irisin protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant Irisin protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human / Mouse / Rat Irisin / FNDC5 Protein
Online Inquiry
Cat#:
RPH-NP386
Product Name:
Recombinant Human / Mouse / Rat Irisin / FNDC5 Protein
Synonym:
Fibronectin type III domain-containing protein 5, Fibronectin type III repeat-containing protein 2, Irisin, FNDC5
Description:
Recombinant Human/Mouse/Rat Irisin Protein is produced in Human Cells and the target gene encoding Asp32-Glu143 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human/Mouse/Rat Irisin/FNDC5 Protein was lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Stability:
Recombinant Human/Mouse/Rat Irisin/FNDC5 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant Irisin protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant Irisin protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant Irisin protein samples are stable below -20°C for 3 months.