• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human HSV-2 gB Protein Online Inquiry

  • Cat#:
  • RP-3923H
  • Product Name:
  • Recombinant Human HSV-2 gB Protein
  • Synonym:
  • HSV
  • Description:
  • The E.coli derived HSV-2 gB recombinant protein is fused to a Six histidine tag at C-terminus and has a MW of 82kDa (pI 8.35).
  • Source:
  • E.coli
  • AA Sequence:
  • MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGT TVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGF YARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH.
  • Purity:
  • Protein is Greater than 90% pure as determined by SDS PAGE.
  • Formulation:
  • 10mM Phosphate buffer pH 7.6 and 75mM NaCl.
  • Stability:
  • Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
  • Pre product:Recombinant Human HSV-1 gG Protein-Advanced Biomart
  • Online Inquiry

    refresh