Cat#:RP-3923H;Product Name:Recombinant Human HSV-2 gB Protein;Synonym:HSV;Description:The E.coli derived HSV-2 gB recombinant protein is fused to a Six histidine tag at C-terminus and has a MW of 82kDa (pI 8.35).;Source:E.coli;AA Sequence:MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGT TVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGF YARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH.;Purity:Protein is Greater than 90% pure as determined by SDS PAGE.;Formulation:10mM Phosphate buffer pH 7.6 and 75mM NaCl.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;