Cat#:RP-3898H;Product Name:Recombinant Human HSP65 Mycobacterium Protein;Synonym:Protein Cpn60-2, groEL protein-2, 65 kDa antigen, Heat shock protein 65, Cell wall protein A, Antigen A, groL2, groEL-2.;Description:Recombinant Mycobacterium Tuberculosis HSP65 is produced in E.coli and has a Mw of 57.4 kDa. The HSP65 protein is fused to His-Tag at N-Terminus and purified by stabdard chromatography techniques.;Source:E.coli;AA Sequence:HHHHHHGSAKTIAYDEEARRGLERGLNALADAVKV TLGPKGRNVVLEKKWGAPTITNDGVSIAKEIELEDPY EKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVRE GLRNVAAGANPLGLKRGIEAVEKVTETLLKGAKEVET KEQIAATAAISAGDQSIGDLIAEAMDKVGNEGVITV EESNTFGLQLELTEGMRFDKGYISGYFVTDPERQEAV LEDPYILLVSSKVSTVKDLLPLLEKVIGAGK;Purity:Greater than 95.0% as determined by SDS-PAGE.;Formulation:The HSP65 protein was lyophilized from a concentrated (1mg/ml) solution containing 10mM Na-phosphate pH-7.4, 130mM NaCl and 2.5mM KCl.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized HSP-65 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized HSP65 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HSP65 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;