Cat#:RP-3820H;Product Name:Recombinant Human HIV-2 gp-36 397aa;Synonym:HIV;Description:HIV-2 gp36 34 kDa recombinant has 397 amino acids and contains the sequence of HIV-2 envelope immunodominant regions gp36. The protein is fused to beta-galactosidase (114 kDa) at N-terminus.;Source:E.coli;AA Sequence:EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCH IKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQ NNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEK RYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQS RTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVT AIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDN MTWQEWEKQ;Purity:Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.;Formulation:0.01M Na2CO3, 0.01M Na3EDTA, 0.014 Mb-mercaptoethanol, 0.05% Tween-20.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:HIV-2 gp-36 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.;