Cat#:RP-3792H;Product Name:Recombinant Human HIV-1 Integrase;Synonym:HIV;Description:The E.coli derived 36 kDa recombinant protein is a non-glycosylated polypeptide chain, containing the HIV-1 immunodominant regions from the pol protein (intergrase) and fused with a six histidines tag.;Source:E.coli;AA Sequence:mfldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgea mhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfilk lagrwpvktihtdngsnftsttvkaacwwagikqefgipynpqsqgviesmn kelkkiigqvrdqaehlktavqmavfihnfkrkggiggysagerivdiiatdiqtk elqkqitkiqnfrvyyrdsrdplwkgpakllwkgegavv;Purity:Greater than 95.0% as determined by SDS-PAGE.;Formulation:1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X & 50% Glycerol.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:HIV-1 Integrase although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.;