Cat#:RP-3785H;Product Name:Recombinant Human HIV-1 gp41 Long ;Synonym:HIV;Description:The E.coli derived protein contains the full-length sequence of N-terminal epitopes of HIV-I gp41 395 amino acids (444-833) immunodominant regions gp41L. The protein is fused to? b-galactosidase (114 kDa) at N-Terminus.;Source:E.coli;AA Sequence:IEFPGIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQ REKRAVGIGALFLG FLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLR AIEAQQHLLQLTVWGIKQLQARIL AVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSN KSLEQIWNNMTWMEWDREINNYTSL IHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAV LSVVNRVR;Purity:Greater than 95.0% as determined by HPLC analysis & SDS-PAGE.;Formulation:8M Urea, 20mM Tris-HCl pH 8.0, 10mM b-mercaptoethanol.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:HIV-1 gp41 Long although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.;