Cat#:RP-3695H;Product Name:Recombinant Human HCV NS4 a+b;Synonym:HCV;Description:The E.coli derived 19 kDa recombinant protein contains the HCV NS4 immunodominant regions, amino acids 1658-1863. The protein is fused with b-galactosidase (114 kDa) at N-terminus, pI 5.45.;AA Sequence:1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREF DEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNW QKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQ TLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGA GVAGAL 1863.;Purity:HCV NS4 a+b protein is Greater than 95% pure as determined by 10% PAGE (coomassie staining).;Formulation:20mM Tris-HCl pH 8, 8M urea.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;
The E.coli derived 19 kDa recombinant protein contains the HCV NS4 immunodominant regions, amino acids 1658-1863. The protein is fused with b-galactosidase (114 kDa) at N-terminus, pI 5.45.