Cat#:RP-3254H;Product Name:Recombinant Human FKBP1A Protein;Synonym:FKBP12, PPIase, Peptidyl-prolyl cis-trans isomerase, Rotamase, FKBP-12, FKBP1, PKC12, PKCI2, FKBP12C, FKBP1A, PPIase FKBP1A, FK506-binding protein 1A, 12 kDa FKBP, FKBP-1A.;Description:FKPB1A Protein fused to N-terminal His-Tag produced in E.coli is a single, non-glycosylated polypeptide chain purified through a Ni2+-affinity chromatography followed by gel filtration.;Source:E.coli;AA Sequence:The amino acid sequence of recombinant His-tagged FKBP12 is reported as following: MAHHHHHHVMGVQVETISPGDGRTFPKRGQTCVV HYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHAT LVFDVELLKLE.;Purity:Greater than 99.0% as determined by SDS-PAGE.;Bioactivity:Please contact us for detailed information;Formulation:The FKBP1A protein solution contains 50mM Hepes pH-8.0, 150mM NaCl, 0.5mM EDTA & 1mM sodium azide.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.;