Cat#:RP-2985H;Product Name:Recombinant Human EBI3 Protein;Synonym:Interleukin-27 subunit beta, IL-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein, EBI3, IL27B.;Description:EBI3 Protein produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa. The EBI3 is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSF IATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVL NVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQ VQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSF ILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK.;Purity:Greater than 90% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.;Bioactivity:Assay data for Human recombinant EBI3 is based upon qualitative binding to anti-EBI3 antibody.;Formulation:EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized EBI3 in sterile 10mM Acetic acid not less than 100µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.;