Cat#:RP-2889H;Product Name:Recombinant Human Der P1;Synonym:Peptidase 1, Major mite fecal allergen Der p 1, Allergen Der p I, Der p 1, DERP1, Der-P1.;Description:The E.coli derived recombinant protein contains the Dermatophagoides pteronyssinus Dust Mite Der P1 protein (a.a. 20-320) and fused to a 6 His Tag at C-terminus, having a total Mw of 34.8kDa, pI 5.8.;Source:E.coli;AA Sequence:MSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFK NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSAWAFS GVAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVA REQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTI IQRDNGYQPNYHAVN;Purity:Protein is Greater than 95% pure as determined by 10% SDS-PAGE (coomassie staining).;Formulation:(1mg/ml) 60mM NaCl, 50mM Tris-HCl pH 8.0 and 1.2M Urea.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;