Cat#:RP-2558H;Product Name:Recombinant Human Chitodextrinase Protein;Synonym:Chitodextrinase;Description:Chitodextrinase Clostridium Botulinum Recombinant fused with a 13 amino acid His tag at N-terminus produced in E.coli is a single, non-glycosylated, polypeptide chain containing 590 amino acids and having a molecular mass of 66.9kDa. The Chitodextrinase is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:HMRGSGSHHHHHHKEKFKTTKIKNSSELNRKLVGYFPEWAYSSEAQGYFNVTD LQWDSLTHIQYSFAMVDPSTNKITLSNKHAAIEEDFSEFDLNYNGKKIELDPS LPYKGHFNVLQTMKKNYPDVSLLISVGGWTGTRCFYTMIDTDNRINTFADSCV DFIRKYGFDGVDIDFEYPSSTSQSGNPDDFDLSEPRRTKLNERYNILIKTLRE KIDMASKEDGKEYLLTAAVTASPWVLGGISDNTYAKYLD;Purity:Greater than 95.0% as determined by SDS-PAGE.;Bioactivity:Please contact us for detailed information;Formulation:Chitodextrinase lyophilized from a 0.2µm filtered concentrated solution in PBS.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized Chitodextrinase in sterile 18M?-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized Chitodextrinase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Chitodextrinase should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;