• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Chitodextrinase Protein Online Inquiry

  • Cat#:
  • RP-2558H
  • Product Name:
  • Recombinant Human Chitodextrinase Protein
  • Synonym:
  • Chitodextrinase
  • Description:
  • Chitodextrinase Clostridium Botulinum Recombinant fused with a 13 amino acid His tag at N-terminus produced in E.coli is a single, non-glycosylated, polypeptide chain containing 590 amino acids and having a molecular mass of 66.9kDa. The Chitodextrinase is purified by proprietary chromatographic techniques.
  • Source:
  • E.coli
  • AA Sequence:
  • HMRGSGSHHHHHHKEKFKTTKIKNSSELNRKLVGYFPEWAYSSEAQGYFNVTD LQWDSLTHIQYSFAMVDPSTNKITLSNKHAAIEEDFSEFDLNYNGKKIELDPS LPYKGHFNVLQTMKKNYPDVSLLISVGGWTGTRCFYTMIDTDNRINTFADSCV DFIRKYGFDGVDIDFEYPSSTSQSGNPDDFDLSEPRRTKLNERYNILIKTLRE KIDMASKEDGKEYLLTAAVTASPWVLGGISDNTYAKYLD
  • Purity:
  • Greater than 95.0% as determined by SDS-PAGE.
  • Bioactivity:
  • Please contact us for detailed information
  • Formulation:
  • Chitodextrinase lyophilized from a 0.2µm filtered concentrated solution in PBS.
  • Stability:
  • Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
  • Reconstitution:
  • It is recommended to reconstitute the lyophilized Chitodextrinase in sterile 18M?-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
  • Storage:
  • Lyophilized Chitodextrinase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Chitodextrinase should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Pre product:Recombinant Human Chitinase Protein-Advanced Biomart
  • Online Inquiry

    refresh