Cat#:RP-2320H;Product Name:Recombinant Human C3c Protein;Synonym:Complement C3c, Complement Component C3c, C3c.;Description:Human C3c produced in Human Plasma having a molecular mass of 137 KDa. Complement C3c consists of three peptides: C3c Beta chain (23-667), C3c alpha chain fragment 1 (749-954) and C3c alpha chain fragment 2 (1321-1663) joined together by disulphide bonds. ?;Source:Human Plasma.;AA Sequence:C3c Beta chain (23-667) SPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNH MGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPG STVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMG QWKIRAYYENSPQQVFSTEFEVKEYVLPSFEVIVEPTEKFYYIYNEKG;Purity:Greater than 96.0%.;Bioactivity:Please contact us for detailed information;Formulation:The Human Complement C3c was lyophilized in a sodium phosphate buffer, pH 7.2, containing 0.15M NaCl.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized C3c in de-ionized water.;Storage:Human C3c although stable at room temperature for 3 weeks, should be stored between 2-8°C.;