Cat#:RP-2255H;Product Name:Recombinant Human BMP7 Protein, Plant;Synonym:Osteogenic Protein 1, BMP-7.;Description:Bone Morphogenetic Protein-7 Protein produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by proprietary chromatographic techniques.;Source:Nicotiana benthamiana.;AA Sequence:HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN SSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAY YCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKP CCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.;Purity:Greater than 97.0% as determined by SDS-PAGE.;Bioactivity:The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg.;Formulation:BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/µl.;Storage:Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;