Cat#:RP-1935H;Product Name:Recombinant Human Ag85B;Synonym:Antigen 85-B, 85B, Extracellular alpha-antigen, Antigen 85 complex B, Ag85B, Mycolyl transferase 85B, EC 2.3.1.-, Fibronectin-binding protein B, 30 kDa extracellular protein, fbpB, A85B, Major Secretory Protein Antigen 85B.;Description:Ag85B Recombinant His-Tag fusion protein produced in E.coli is a single, non-glycosylated polypeptide chain having a molecular mass of 30kDa.;Source:E.coli;AA Sequence:MRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQ DDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETF LTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDP SQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVY CGNGTPNELGGANIPAEFLENFVRSSNLKFQ;Purity:Greater than 90.0% as determined by SDS-PAGE.;Bioactivity:Please contact us for detailed information;Formulation:Lyophilized with 0.1% glycerol.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized Antigen-85B in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Ag85B although stable room temperature for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;