Cat#:RPH-NP014;Product Name:Recombinant Human Alcohol Dehydrogenase Class 4 Mu / ADH7 Protein;Synonym:Alcohol Dehydrogenase Class 4 Mu/Sigma Chain, Alcohol Dehydrogenase Class IV Mu/Sigma Chain, Gastric Alcohol Dehydrogenase, Retinol Dehydrogenase, ADH7;Description:Recombinant Human ADH7 Protein is produced in Human Cells and the target gene encoding Met1-Phe386 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHV IKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCIRSDIT GRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAA VKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKDSTK PISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRT WKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTFVDHH HHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Alcohol Dehydrogenase Class 4 Mu/ADH7 Protein was lyophilized from a 0.2 μm filtered solution of PBS,PH7.4.;Stability:Recombinant Human Alcohol Dehydrogenase Class 4 Mu/ADH7 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Recombinant Human Alcohol Dehydrogenase Class 4 Mu/ADH7 Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human ADH7 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human ADH7 samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Alcohol Dehydrogenase Class 4 Mu/ADH7 Protein was lyophilized from a 0.2 μm filtered solution of PBS,PH7.4.
Stability:
Recombinant Human Alcohol Dehydrogenase Class 4 Mu/ADH7 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized Recombinant Human Alcohol Dehydrogenase Class 4 Mu/ADH7 Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human ADH7 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human ADH7 samples are stable below -20°C for 3 months.