Cat#:RPH-NP012;Product Name:Recombinant Human Activin Receptor 2B / Activin RIIB / ACVR2B Protein;Synonym:Activin Receptor Type-2B, Activin Receptor Type IIB, ACTR-IIB, ACVR2B;Description:Recombinant Human Activin Receptor IIB Protein is produced in Human Cells and the target gene encoding Ser19-Thr134 is expressed with a Fc, His tag at the C-terminus.;Source:Human Cells;AA Sequence:SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFN CYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTVDDIEGRMDEPKSC DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Activin Receptor 2B/Activin RIIB/ACVR2B Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Activin Receptor 2B/Activin RIIB/ACVR2B Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human ACVR2B protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human ACVR2B protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human ACVR2B protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human Activin Receptor 2B / Activin RIIB / ACVR2B Protein
Online Inquiry
Cat#:
RPH-NP012
Product Name:
Recombinant Human Activin Receptor 2B / Activin RIIB / ACVR2B Protein
Synonym:
Activin Receptor Type-2B, Activin Receptor Type IIB, ACTR-IIB, ACVR2B
Description:
Recombinant Human Activin Receptor IIB Protein is produced in Human Cells and the target gene encoding Ser19-Thr134 is expressed with a Fc, His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Activin Receptor 2B/Activin RIIB/ACVR2B Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Stability:
Recombinant Human Activin Receptor 2B/Activin RIIB/ACVR2B Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human ACVR2B protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human ACVR2B protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human ACVR2B protein samples are stable below -20°C for 3 months.