Cat#:RP-1885H;Product Name:Recombinant Human Acrp30 Protein;Synonym:Acrp30, AdipoQ, GBP-28, APM-1, ACDC.;Description:The Adiponectin Protein protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244).;Source:E.coli;AA Sequence:MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGE KGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSV GLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKD VKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGE RNGLYADNDNDSTFTGFLLYHDTN.;Purity:Acrp30 purity is Greater than 90% as determined by SDS-PAGE.;Bioactivity:Please contact us for detailed information;Formulation:Acrp30 protein solution contains Phosphate buffered saline pH 7.4 and 1mM DTT.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;