Cat#:RPH-NP383;Product Name:Recombinant Human β-Nerve Growth Factor / β-NGF Protein (Ser122-Ala241, E. coli);Synonym:Beta-Nerve Growth Factor, Beta-NGF, NGF, NGFB;Description:Recombinant Human beta-Nerve Growth Factor Protein is produced in E.coli and the target gene encoding Ser122-Ala241 is expressed.;Source:E.coli;AA Sequence:SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVD SGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:ED50 is less than 1.0 ng/ml. Specific Activity is greater than 1 x 10^6 IU/mg.;Formulation:Recombinant Human β-Nerve Growth Factor/β-NGF Protein (Ser122-Ala241, E. coli)was lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.0.;Stability:Recombinant Human β-Nerve Growth Factor/β-NGF Protein (Ser122-Ala241, E. coli)is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human β-NGF protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human β-NGF protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human β-NGF protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;