• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human VEGFC Protein Online Inquiry

Cat#:RPH-NP373
Product Name:Recombinant Human VEGFC Protein
Synonym: Vascular Endothelial Growth Factor C, VEGF-C, Flt4 Ligand, Flt4-L, Vascular Endothelial Growth Factor-Related Protein, VRP, VEGFC
Description: Recombinant Human Vascular Endothelial Growth Factor C Protein is produced in Human Cells and the target gene encoding Phe32-Arg227 is expressed with a His tag at the C-terminus.
Source: Human Cells
AA Sequence: FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQ ANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYR CGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIR RVDHHHHHH
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin: < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation: Recombinant Human VEGFC Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Stability: Recombinant Human VEGFC Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution: Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage: For Lab Research Use Only
Storage: Lyophilized recombinant human VEGFC protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human VEGFC protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human VEGFC protein samples are stable below -20°C for 3 months.

Online Inquiry

refresh