Cat#:RPH-NP371;Product Name:Recombinant Human VEGF-A / VEGF121 Protein;Synonym:Vascular endothelial growth factor A,VEGFA,VEGF-A,Vascular permeability factor,VPF,VEGF,VEGF121;Description:Recombinant Human Vascular Endothelial Growth Factor A Protein is produced in E.coli and the target gene encoding Ala27-Arg147 is expressed.;Source:E.coli;AA Sequence:MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDE GLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human VEGF-A/VEGF121 Protein was lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.;Stability:Recombinant Human VEGF-A/VEGF121 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human VEGFA protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human VEGFA protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human VEGFA protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;