Cat#:RPH-NP217;Product Name:Recombinant Human Interleukin-17F / IL17F Protein;Synonym:Interleukin-17F, IL-17F, Cytokine ML-1, Interleukin-24, IL-24, IL17F, IL24;Description:Recombinant Human Interleukin-17F Protein is produced in E.coli and the target gene encoding Arg31-Gln163 is expressed.;Source:E.coli;AA Sequence:MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYP SEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVI HHVQ;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:ED50 is approximately 10 ng/ml. Specific Activity of 1.0 x 10^5 IU/mg;Formulation:Recombinant Human Interleukin-17F/IL17F Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, pH 7.4.;Stability:Recombinant Human Interleukin-17F/IL17F Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 500mM Acetic Acid.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL17F Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL17F protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IL17F protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;