• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Interleukin-10 / IL10 Protein(His Tag) Online Inquiry

Cat#:RPH-NP206
Product Name:Recombinant Human Interleukin-10 / IL10 Protein(His Tag)
Synonym: Interleukin-10, IL-10, Cytokine Synthesis Inhibitory Factor, CSIF, IL10
Description: Recombinant Human Interleukin-10 Protein is produced in E.coli and the target gene encoding Ser19-Asn178 is expressed with a His tag at the N-terminus.
Source: E.coli
AA Sequence: MGSSHHHHHHSSGLVPRGSHMSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLD NLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCH RFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin: < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Bioactivity: ED50 is less than 2 ng/ml. Specific Activity of 1.5 x 10^6 IU/mg.
Formulation: Recombinant Human Interleukin-10/IL10 Protein (His Tag)was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Stability: Recombinant Human Interleukin-10/IL10 Protein (His Tag)is stable for up to 1 year from date of receipt at -70℃.
Reconstitution: Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage: For Lab Research Use Only
Storage: Lyophilized recombinant human IL10 Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL10 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IL10 protein samples are stable below -20°C for 3 months.

Online Inquiry

refresh