Cat#:RPH-NP184;Product Name:Recombinant Human ICOS / CRP-1 / AILIM / CD278 Protein;Synonym:Inducible T-cell costimulator,activation-inducible lymphocyte immunomediatory molecule, CD278, AILIM, CVID1,ICOS,;Description:Recombinant Human Inducible T-cell costimulator Protein is produced in Human Cells and the target gene encoding Glu21-Phe141 is expressed with a Fc tag at the C-terminus.;Source:Human Cells;AA Sequence:EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHS QLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFVDDIEGRMD EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human ICOS/CRP-1/AILIM/CD278 Protein was lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .;Stability:Recombinant Human ICOS/CRP-1/AILIM/CD278 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Recombinant Human ICOS/CRP-1/AILIM/CD278 Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted ICOS protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted ICOS protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;