Cat#:RPH-NP100;Product Name:Recombinant Human C-X-C Motif Chemokine 5 / CXCL5 Protein;Synonym:C-X-C Motif Chemokine 5, ENA-78 (1-78), Epithelial-Derived Neutrophil-Activating Protein 78, Neutrophil-Activating Peptide ENA-78, Small-Inducible Cytokine B5, ENA-78 (8-78), ENA-78 (9-78), CXCL5, ENA78, SCYB5;Description:Recombinant Human C-X-C Motif Chemokine 5 Protein is produced in E.coli and the target gene encoding Leu44-Asn114 is expressed.;Source:E. coli;AA Sequence:MLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKIL DGGNKEN;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human C-X-C Motif Chemokine 5/CXCL5 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, pH 6.0.;Stability:Recombinant Human C-X-C Motif Chemokine 5/CXCL5 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CXCL5 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human CXCL5 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CXCL5 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;