• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human ABHD14B Protein, His Tag Online Inquiry

Cat#:RP-6587H
Product Name:Recombinant Human ABHD14B Protein, His Tag
Source: E. coli
AA Sequence: MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ
Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Formulation: Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0) and 10% glycerol.
Stability: Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Storage: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.

Online Inquiry

refresh