Cat#: | RP-16145H |
Product Name: | Recombinant Human ULBP1 Protein, His Tag |
Source: | E. coli |
AA Sequence: | GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPKAMATTLSPWSLLIIFLCFILAGR |
Purity: | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Formulation: | Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization. |
Stability: | Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃ |
Reconstitution: | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. |
Storage: | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles. |