Rat anti-Mouse VKORC1L1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06751P

• Product Name:
• Rat anti-Mouse VKORC1L1 Polyclonal Antibody

• Synonym:
• 2310024K08Rik

• Description:
• The antibody against VKORC1L1 was raised in Rat using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of mouse VKORC1L1 (NP_081397.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rat

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of mouse VKORC1L1 (NP_081397.1).

• Species Reactivity:
• Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• VKORC1L1

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• LLGMTASAVAALVLMTSSIVSVVGSLYLAYILYFVLKEFCIICVTTYVLNFLLLIINYKRLVYLNEAWKRQLQPKED

• Gene ID:
• 69568

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat lung, Rat liver