Rabbit anti-Rat TNFα Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08078P

• Product Name:
• Rabbit anti-Rat TNFα Polyclonal Antibody

• Synonym:
• Tnfa; RATTNF; TNF-alpha; TNFα

• Description:
• The antibody against TNFα was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-235 of rat TNFα (NP_036807.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 80-235 of rat TNFα (NP_036807.1).

• Species Reactivity:
• Human, Mouse, Rat, Other (Wide Range Predicted)

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TNFα

• Form:
• Liquid

• Immunogen Species:
• Rat

• Immunogen Sequence:
• LRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL

• Gene ID:
• 24835

• Uniprot-ID:
• P16599

• Purification Method:
• Affinity purification

• Positive Samples:
• THP-1 treated by TPA+LPS, Recombinant Rat TNF-alpha Protein, Raw 264.7 treated by LPS