Rabbit anti-Rat IL1β Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12496P

• Product Name:
• Rabbit anti-Rat IL1β Polyclonal Antibody

• Synonym:
• IL-1F2; IL1β

• Description:
• The antibody against IL1β was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 117-268 of rat IL1β (NP_113700.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 117-268 of rat IL1β (NP_113700.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• IL1β

• Form:
• Liquid

• Immunogen Species:
• Rat

• Immunogen Sequence:
• VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS

• Gene ID:
• 24494

• Uniprot-ID:
• Q63264

• Purification Method:
• Affinity purification

• Positive Samples:
• THP-1, Mouse spleen, Rat lung