Rabbit anti-Mouse Zswim8 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-06772P

• Product Name:
• Rabbit anti-Mouse Zswim8 Polyclonal Antibody

• Synonym:
• Kiaa0913; mKIAA0913; 2310021P13Rik; 4832404P21Rik; Zswim8

• Description:
• The antibody against Zswim8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1600-1700 of mouse Zswim8 (NP_082272.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1600-1700 of mouse Zswim8 (NP_082272.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Zswim8

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• PLPTSVALSSVHPASTFPAIQGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGRRAHNDHPNNFSRSPPYTDDVKWLLG

• Gene ID:
• 268721

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain